If you want to know Turmeric Powder, Rice, Granite Stone & Chilli’s FOB & CIF Price In India? Your search ends at PLOW EXPORTS & IMPORTS PRIVATE LIMITED. To know more about, call us on +91 8121806944 or +91 9951818715.

2.50 Rating by CuteStat

plowexim.com is 9 years 2 hours old. It is a domain having com extension. It has a global traffic rank of #3789668 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, plowexim.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 222
Daily Pageviews: 444

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,789,668
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: 3
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: UA-143113301-1

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 16 Jan 2021 05:52:57 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Length: 19033
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registration Date: May 19, 2015, 7:35 PM 9 years 2 hours 44 minutes ago
Expiration Date: May 19, 2021, 7:35 PM 2 years 11 months 3 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
plowexim.com A 14396 IP: 103.24.200.143
plowexim.com NS 86400 Target: ns1.lazybulls.com
plowexim.com NS 86400 Target: ns2.lazybulls.com
plowexim.com SOA 86400 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2020071300
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
plowexim.com MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
plowexim.com MX 14400 Target: aspmx.l.google.com
plowexim.com MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
plowexim.com MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
plowexim.com MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
plowexim.com TXT 14400 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141 ip4:142.44.174.193
ip4:103.24.202.75 +a +mx
+ip4:192.163.253.54 ~all

Similarly Ranked Websites

HOME - Websnipers

- websnipers.com
3,789,676 $ 240.00

Magazinshop Roupas Masculina e Feminina no atacado

- magazinshop.com.br

Venha Conferir nossas super ofertas na Magazinshop, Aqui Você encontra camisas e camisetas de marca, gola redonda e gola v - [Camisetas de marca 2017]

3,789,683 $ 240.00

Woolnia. Tamo gde se štrikaju čula

- woolnia.com

Ručno rađena ćebad, džemperi, kape i šalovi od čiste merino vune. Unikatan dizajn, prirodni materijali i kvalitetna izrada je ono što čini naše proizvode jedinstvenim. Mi štrikamo čula.

3,789,685 $ 240.00

EPEVER Online Training

- epsolarpv.online
3,789,694 $ 240.00

Bytt bad. Inspirerande baderomsinnredninger. - Hafa Baderom

- hafabad.no

Hafa - Her kan du innrede ditt bad slik du vil. Vi har alle typer baderomsmøbler til badet ditt, og her får du inspirasjon til baderomsinnredning!

3,789,695 $ 240.00

Full WHOIS Lookup

Domain Name: PLOWEXIM.COM
Registry Domain ID: 1930354638_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2020-04-30T07:21:12Z
Creation Date: 2015-05-19T13:50:38Z
Registrar Registration Expiration Date: 2021-05-19T13:50:38Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Vijay K
Registrant Organization: Plow Exports & Imports Private Limited
Registrant Street: Do. No 48-11/8-19, Currency Nagar
Registrant City: Vijayawada
Registrant State/Province: Andhra Pradesh
Registrant Postal Code: 520008
Registrant Country: IN
Registrant Phone: +91.8121806944
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@plowexim.com
Registry Admin ID: Not Available From Registry
Admin Name: Vijay K
Admin Organization: Plow Exports & Imports Private Limited
Admin Street: Do. No 48-11/8-19, Currency Nagar
Admin City: Vijayawada
Admin State/Province: Andhra Pradesh
Admin Postal Code: 520008
Admin Country: IN
Admin Phone: +91.8121806944
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@plowexim.com
Registry Tech ID: Not Available From Registry
Tech Name: Vijay K
Tech Organization: Plow Exports & Imports Private Limited
Tech Street: Do. No 48-11/8-19, Currency Nagar
Tech City: Vijayawada
Tech State/Province: Andhra Pradesh
Tech Postal Code: 520008
Tech Country: IN
Tech Phone: +91.8121806944
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@plowexim.com
Name Server: ns1.lazybulls.com
Name Server: ns2.lazybulls.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-16T05:53:09Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: LAZY BULLS DOMAIN AND HOSTING SERVICES

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.